PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0178s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 573aa    MW: 64985 Da    PI: 4.9321
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0178s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.45.1e-1316100899
                          -HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3   8 sdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                           ++++ + l +p  f e++ +g + +++   l++ ++ + W+v +   ++s    + +GW eF++a++Lk+g f+vFk+dg + f  +v+
  Kalax.0178s0050.1.p  16 LHNFAAN-LAIPVAFYEKYlEGRPGCGTRAELRSrLRRQGWKVWM--VGRS----IVDGWAEFADAHELKVGYFLVFKYDGGTVF--HVS 96 
                          4556655.9***********9999**********778899*****..8888....899*********************998888..**9 PP

                          EE-S CS
                   B3  96 vfrk 99 
                          vf+ 
  Kalax.0178s0050.1.p  97 VFDP 100
                          9986 PP

2B350.73.1e-161452231696
                          EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                          l +p  f+++++++  +s +++++de g+ W vk++ +k++++++  +GW++Fv+ ngL+ gD + F+ ++ +++ +v+++
  Kalax.0178s0050.1.p 145 LHFPACFCAANKLNVSCS-EIIVKDEAGKAWPVKVKCKKGGNAVYTMGGWRSFVEGNGLQKGDRFNFRIVS-KGKIPVLSF 223
                          569999*****9998887.****************9999999999999********************765.444445444 PP

3B332.51.5e-103514321498
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                            l++p  f +++++++ +  ++ ++d +g+ W v+++ +++ + ++  +GW +  + ng++ gD   F++++  ++++v++++r
  Kalax.0178s0050.1.p 351 TSLYFPVYFSRANNLDS-C-SEIDVKDDRGKLWPVNIRLKRNTNLVYTVGGWTSLIRGNGIRKGDRYEFRVIS-YGTKPVLSFRR 432
                          34689999999999983.4.49***************99999999999**********************987.67778877765 PP

4B345.21.7e-14472564697
                          ..-HHHHTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3   6 tpsdvlksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                          ++  +l ++rl l  +fa+ +   +    +s +++l++++g+sW  +l+ +++s r+++t+GW eF+ angL++g ++ +++++ +++ l
  Kalax.0178s0050.1.p 472 ITQASLDRSRLFLGINFAKMNglaD--RDRSGDMILRNSQGKSWVATLKREGNSFRFFITNGWTEFALANGLEAGRVFRLEVVEPESKLL 559
                          4566778889***********7533..347779***************88999999***********************99887666656 PP

                          EEEEE CS
                   B3  93 vvkvf 97 
                          ++k+ 
  Kalax.0178s0050.1.p 560 TLKLT 564
                          66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-155103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.89E-175107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.2078101IPR003340B3 DNA binding domain
CDDcd100179.29E-15999No hitNo description
SMARTSM010192.2E-1311101IPR003340B3 DNA binding domain
PfamPF023625.8E-92099IPR003340B3 DNA binding domain
SuperFamilySSF1019365.49E-17126224IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-15128224IPR015300DNA-binding pseudobarrel domain
CDDcd100174.67E-14132225No hitNo description
SMARTSM010198.1E-13133227IPR003340B3 DNA binding domain
PfamPF023623.1E-14143224IPR003340B3 DNA binding domain
PROSITE profilePS5086312.407163226IPR003340B3 DNA binding domain
PROSITE profilePS5086310.941338433IPR003340B3 DNA binding domain
CDDcd100172.77E-10338432No hitNo description
Gene3DG3DSA:2.40.330.105.4E-10338440IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-12340434IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.4E-10345434IPR003340B3 DNA binding domain
PfamPF023628.2E-9352432IPR003340B3 DNA binding domain
PROSITE profilePS5086312.731467567IPR003340B3 DNA binding domain
CDDcd100172.05E-12467558No hitNo description
SuperFamilySSF1019361.86E-14467559IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.7E-13468567IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-12469561IPR015300DNA-binding pseudobarrel domain
PfamPF023626.7E-13471566IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MANPSPKIPH FFQPLLHNFA ANLAIPVAFY EKYLEGRPGC GTRAELRSRL RRQGWKVWMV  60
GRSIVDGWAE FADAHELKVG YFLVFKYDGG TVFHVSVFDP SACEVEYGDE HDEDNAVEGD  120
GEELKMDSGQ TSYVGTLRPS YLISLHFPAC FCAANKLNVS CSEIIVKDEA GKAWPVKVKC  180
KKGGNAVYTM GGWRSFVEGN GLQKGDRFNF RIVSKGKIPV LSFRRIGGMR DQTEVATRAK  240
RRKAVEVPKL DTSAGEVEHP SLDEDEDDDV EQDDEEDTVE EDDDEDLLEE DEEEEDMVEE  300
DYDEEEDMVD GDDEEHKTEL DHSRKRMKNR NPDTDESTAS YVGKMCRAYL TSLYFPVYFS  360
RANNLDSCSE IDVKDDRGKL WPVNIRLKRN TNLVYTVGGW TSLIRGNGIR KGDRYEFRVI  420
SYGTKPVLSF RRIGPKRKAG LEEEEKVPEL ALRHFEKTTG SLIPGTYLIR TITQASLDRS  480
RLFLGINFAK MNGLADRDRS GDMILRNSQG KSWVATLKRE GNSFRFFITN GWTEFALANG  540
LEAGRVFRLE VVEPESKLLT LKLTRRVTLE DL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1323329RKRMKNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.14e-44B3 family protein